(data stored in ACNUC7421 zone)

EMBL: CP000947.PE183

CP000947.PE183       Location/Qualifiers
FT   CDS             complement(197193..197456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0185"
FT                   /product="Haemophilus-specific protein, uncharacterized"
FT                   /note="KEGG: hso:HS_0314 Haemophilus-specific protein,
FT                   uncharacterized"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31638"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP6"
FT                   /protein_id="ACA31638.1"
FT                   /translation="MSNRIEITVDIYKNFFGDTSDSPYVYDNIKAINPNEQKEVDEIVN
FT                   KMIANGSSQLFDSNLNILNPITPLETGRKCFLNPQTLCIEFK"
     MSNRIEITVD IYKNFFGDTS DSPYVYDNIK AINPNEQKEV DEIVNKMIAN GSSQLFDSNL        60
     NILNPITPLE TGRKCFLNPQ TLCIEFK                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page