(data stored in ACNUC7421 zone)

EMBL: CP000947.PE184

CP000947.PE184       Location/Qualifiers
FT   CDS             complement(197940..198902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0186"
FT                   /product="lipoic acid synthetase"
FT                   /note="TIGRFAM: lipoic acid synthetase; PFAM: Radical SAM
FT                   domain protein; SMART: Elongator protein 3/MiaB/NifB; KEGG:
FT                   hso:HS_0315 lipoate biosynthesis protein A (lipoate
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31649"
FT                   /db_xref="GOA:B0UVP7"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVP7"
FT                   /protein_id="ACA31649.1"
FT                   /translation="MTTPFKMERGVKYRDAAKTSIIPVKNIDPNQELLKKPEWMKIKLP
FT                   ANSAKINSIKNGMRRHGLHSVCEEASCPNLHECFNHGTATFMILGAICTRRCPFCDVAH
FT                   GKPLPPDPDEPKKLAETIQDMKLRYVVITSVDRDDLPDRGAGHFAECVKEIRKLNPGIK
FT                   IEILVPDFRGRIEQALEKLKDNPPDVFNHNLENVPRLYREIRPGADYNWSLKLLKEFKT
FT                   IFPHIPTKSGIMVGLGETNEEILQVMQDLRDNGVTMLTLGQYLQPSRHHLPVARYVPPE
FT                   EFDDFRDKAEKMGFEHAACGPFVRSSYHADLQASGGLVK"
     MTTPFKMERG VKYRDAAKTS IIPVKNIDPN QELLKKPEWM KIKLPANSAK INSIKNGMRR        60
     HGLHSVCEEA SCPNLHECFN HGTATFMILG AICTRRCPFC DVAHGKPLPP DPDEPKKLAE       120
     TIQDMKLRYV VITSVDRDDL PDRGAGHFAE CVKEIRKLNP GIKIEILVPD FRGRIEQALE       180
     KLKDNPPDVF NHNLENVPRL YREIRPGADY NWSLKLLKEF KTIFPHIPTK SGIMVGLGET       240
     NEEILQVMQD LRDNGVTMLT LGQYLQPSRH HLPVARYVPP EEFDDFRDKA EKMGFEHAAC       300
     GPFVRSSYHA DLQASGGLVK                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page