(data stored in ACNUC7421 zone)

EMBL: CP000947.PE185

CP000947.PE185       Location/Qualifiers
FT   CDS             complement(198920..199576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0187"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: hso:HS_0316
FT                   lipoate biosynthesis protein B (lipoyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31660"
FT                   /db_xref="GOA:B0UVP8"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVP8"
FT                   /protein_id="ACA31660.1"
FT                   /translation="MTDTTLIIRQLGIQDYQQVWQQMREFTDTRNVLTADEIWLVQHPA
FT                   VFTQGQAGKPEHLLNPTDIPVVQSDRGGQITYHGLGQQIMYVLIDIKRHKANGSELNVR
FT                   QLVTALEQSVVSTLADYGIKSYPKADAPGVYVNEQKICSLGLRIRKGCSFHGLALNINM
FT                   DLSPFRQINPCGYIGLEMCQMADFIPTEQAQCDKVAPKLVTHFTQLLGYNDVTTY"
     MTDTTLIIRQ LGIQDYQQVW QQMREFTDTR NVLTADEIWL VQHPAVFTQG QAGKPEHLLN        60
     PTDIPVVQSD RGGQITYHGL GQQIMYVLID IKRHKANGSE LNVRQLVTAL EQSVVSTLAD       120
     YGIKSYPKAD APGVYVNEQK ICSLGLRIRK GCSFHGLALN INMDLSPFRQ INPCGYIGLE       180
     MCQMADFIPT EQAQCDKVAP KLVTHFTQLL GYNDVTTY                               218
//

If you have problems or comments...

PBIL Back to PBIL home page