(data stored in ACNUC7421 zone)

EMBL: CP000947.PE186

CP000947.PE186       Location/Qualifiers
FT   CDS             complement(199585..199881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0188"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   hso:HS_0317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31669"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP9"
FT                   /protein_id="ACA31669.1"
FT                   /translation="MTDKTVKLNDIPQKQLKDLLEFPCSFTFKVVGKNRADLIDDVVMV
FT                   TQKYAKGDYNPRQNISSKGTYNSISVDIIAENIEQVEILYTELAKIDGVRMVL"
     MTDKTVKLND IPQKQLKDLL EFPCSFTFKV VGKNRADLID DVVMVTQKYA KGDYNPRQNI        60
     SSKGTYNSIS VDIIAENIEQ VEILYTELAK IDGVRMVL                                98
//

If you have problems or comments...

PBIL Back to PBIL home page