(data stored in ACNUC7421 zone)

EMBL: CP000947.PE188

CP000947.PE188       Location/Qualifiers
FT   CDS             complement(201814..202929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0192"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein; KEGG: hso:HS_0320 rod shape-determining
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31710"
FT                   /db_xref="GOA:B0UVQ1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ1"
FT                   /protein_id="ACA31710.1"
FT                   /translation="MEKKNIWLILWRRLHIDFWLFLGLVTISSYGLLVLYSAVGGSEKM
FT                   FRNRIIQVALGFTVMFVMAQFSPRFYQRIAPYGFVIGVILLLLVDLFGTTSKGAQRWLD
FT                   LGIFRFQPSEIVKLSVPLMVATYLGKRPLPPKLSEIFIALLLIIVPTLLVAIQPDLGTS
FT                   ILVSASGIFVVFLAGINWWFILIAIVGLAAFTPIVWLYLMHDYQRTRVLTLLDPEKDPL
FT                   GAGYHIMQSKIAIGSGGIWGKGWMQGTQSQLEFLPEPHTDFIFAVLSEEYGMTGFTILM
FT                   LIYLFIVARGLIIGVNAQNSFGRILSGALTLIFFVYVFVNIGMVSGILPVVGVPLPLMS
FT                   YGGTSFVTLMAGFGLIMSIHTHKNNFFKGTK"
     MEKKNIWLIL WRRLHIDFWL FLGLVTISSY GLLVLYSAVG GSEKMFRNRI IQVALGFTVM        60
     FVMAQFSPRF YQRIAPYGFV IGVILLLLVD LFGTTSKGAQ RWLDLGIFRF QPSEIVKLSV       120
     PLMVATYLGK RPLPPKLSEI FIALLLIIVP TLLVAIQPDL GTSILVSASG IFVVFLAGIN       180
     WWFILIAIVG LAAFTPIVWL YLMHDYQRTR VLTLLDPEKD PLGAGYHIMQ SKIAIGSGGI       240
     WGKGWMQGTQ SQLEFLPEPH TDFIFAVLSE EYGMTGFTIL MLIYLFIVAR GLIIGVNAQN       300
     SFGRILSGAL TLIFFVYVFV NIGMVSGILP VVGVPLPLMS YGGTSFVTLM AGFGLIMSIH       360
     THKNNFFKGT K                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page