(data stored in ACNUC7421 zone)

EMBL: CP000947.PE189

CP000947.PE189       Location/Qualifiers
FT   CDS             complement(202952..204856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0193"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   hso:HS_0321 cell elongation-specific transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31721"
FT                   /db_xref="GOA:B0UVQ2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ2"
FT                   /protein_id="ACA31721.1"
FT                   /translation="MNLKKLLSQPLQTPIRDKKAERNLFARRALIAFLGVLGLSALLFT
FT                   NLYYLQIVNYETYQTRSNGNRIKLLPLPPTRGLIYDRYGKLLAENITFLGLYIVPEKVE
FT                   DLNRTFEELRYIVGLNDDDIENFKKERRRSSRYMPILLKGDLSEEQIARFAVNQYHYPS
FT                   LDIRPYFKRHYLYGEPLTHILGYVAKINEKDVERLKKNEKYANYAGTHDIGKLGIERYY
FT                   EDDLHGKVGFEEVEVNNRGKVIRKLREQPAIAGKSIHLTIDLELQRYIANLLGNLRAAV
FT                   VVLDPKDSGILAMVSTPSYDNNLFVGGISSADYKQLLTDPNRPLYSRVTQGAYPPASTI
FT                   KPFVAIAGLQENLITTNTTIFDPGYWILPNTTKRFRDWKKSGHGYTDLNKAIVESSDTY
FT                   FYQLAYDMGISRLSQWMKRFGFGVPTGIDIQEETAALMPSREWKQKRYKRPWVQGDTIS
FT                   VGIGQGYWTATPLQVAKATAVLVNNGKVNTPHLMKAIEGSEMQPYQDPRLYEDITEPQA
FT                   VFWETIKQSMYNVIHAPNGTGRKSFIDVSYPVAGKSGTAQVFSLKENQTYNANELDNKL
FT                   HDHAWFIGYAPYDNPKMVVVVILENAGGGSSKAGPVVRKIMDYYLNIRLPQVQSQNEK"
     MNLKKLLSQP LQTPIRDKKA ERNLFARRAL IAFLGVLGLS ALLFTNLYYL QIVNYETYQT        60
     RSNGNRIKLL PLPPTRGLIY DRYGKLLAEN ITFLGLYIVP EKVEDLNRTF EELRYIVGLN       120
     DDDIENFKKE RRRSSRYMPI LLKGDLSEEQ IARFAVNQYH YPSLDIRPYF KRHYLYGEPL       180
     THILGYVAKI NEKDVERLKK NEKYANYAGT HDIGKLGIER YYEDDLHGKV GFEEVEVNNR       240
     GKVIRKLREQ PAIAGKSIHL TIDLELQRYI ANLLGNLRAA VVVLDPKDSG ILAMVSTPSY       300
     DNNLFVGGIS SADYKQLLTD PNRPLYSRVT QGAYPPASTI KPFVAIAGLQ ENLITTNTTI       360
     FDPGYWILPN TTKRFRDWKK SGHGYTDLNK AIVESSDTYF YQLAYDMGIS RLSQWMKRFG       420
     FGVPTGIDIQ EETAALMPSR EWKQKRYKRP WVQGDTISVG IGQGYWTATP LQVAKATAVL       480
     VNNGKVNTPH LMKAIEGSEM QPYQDPRLYE DITEPQAVFW ETIKQSMYNV IHAPNGTGRK       540
     SFIDVSYPVA GKSGTAQVFS LKENQTYNAN ELDNKLHDHA WFIGYAPYDN PKMVVVVILE       600
     NAGGGSSKAG PVVRKIMDYY LNIRLPQVQS QNEK                                   634
//

If you have problems or comments...

PBIL Back to PBIL home page