(data stored in ACNUC7421 zone)

EMBL: CP000947.PE19

CP000947.PE19        Location/Qualifiers
FT   CDS             complement(16190..16516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0019"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: hso:HS_0153 conserved hypothetical protein, with TPR
FT                   repeat (tetratrico peptide repeat)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31688"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX7"
FT                   /protein_id="ACA31688.1"
FT                   /translation="MNLKKSLLTALLSFGIVQSTLAETDTERFNRALQFIKQQNYSDAF
FT                   PLFKQLAEQGDANAQHNLGVMYENGQSVQRNVSKAKQYYRLACDNGLNIGCQTYAKLDK
FT                   KGIK"
     MNLKKSLLTA LLSFGIVQST LAETDTERFN RALQFIKQQN YSDAFPLFKQ LAEQGDANAQ        60
     HNLGVMYENG QSVQRNVSKA KQYYRLACDN GLNIGCQTYA KLDKKGIK                    108
//

If you have problems or comments...

PBIL Back to PBIL home page