(data stored in ACNUC7421 zone)

EMBL: CP000947.PE190

CP000947.PE190       Location/Qualifiers
FT   CDS             complement(204873..205340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0194"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   hso:HS_0322 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31732"
FT                   /db_xref="GOA:B0UVQ3"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVQ3"
FT                   /protein_id="ACA31732.1"
FT                   /translation="MKIQLIAVGTKMPDWVTKGFEEYQRRFPKDMPFELIEIPAGKRGK
FT                   NADIKRILEQEGKAMLSACQKSRIITLDIPGKPWTTEQLAQQLEAWKHDGRNVALLIGG
FT                   PEGLSPECKAATEQSWSLSPLTLPHPLVRIVVAESLYRAWSLSTNHPYHRE"
     MKIQLIAVGT KMPDWVTKGF EEYQRRFPKD MPFELIEIPA GKRGKNADIK RILEQEGKAM        60
     LSACQKSRII TLDIPGKPWT TEQLAQQLEA WKHDGRNVAL LIGGPEGLSP ECKAATEQSW       120
     SLSPLTLPHP LVRIVVAESL YRAWSLSTNH PYHRE                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page