(data stored in ACNUC7421 zone)

EMBL: CP000947.PE191

CP000947.PE191       Location/Qualifiers
FT   CDS             complement(205360..205668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0195"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: hso:HS_0323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31743"
FT                   /db_xref="GOA:B0UVQ4"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ4"
FT                   /protein_id="ACA31743.1"
FT                   /translation="MNLVDFLVSKLDDLKGTDILALDVRGKSSITDHMILCTGTSSRHV
FT                   ISLAQKLIDESKQAGIDTFGEEGKSTADWIAIDFGQAIVHIMQADSREMYQLEKLWG"
     MNLVDFLVSK LDDLKGTDIL ALDVRGKSSI TDHMILCTGT SSRHVISLAQ KLIDESKQAG        60
     IDTFGEEGKS TADWIAIDFG QAIVHIMQAD SREMYQLEKL WG                          102
//

If you have problems or comments...

PBIL Back to PBIL home page