(data stored in ACNUC7421 zone)

EMBL: CP000947.PE192

CP000947.PE192       Location/Qualifiers
FT   CDS             complement(206021..206863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0196"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: hso:HS_0325 chelated iron
FT                   ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31754"
FT                   /db_xref="GOA:B0UVQ5"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ5"
FT                   /protein_id="ACA31754.1"
FT                   /translation="MFNTIVAWFTEPLVYPFMQQAIIIAPIIGAVCAILSCYLVLKGWS
FT                   LMGDAISHAVLPGIILAYVLAIPIAIGAFWAGIFCAVSVGYLRDNSRIKEDTVMGIVFS
FT                   GMFAFGLVLFSKVETDQHLMHILFGNILGIIKQEFWQSIGIALLAFILIALKRKDLLLY
FT                   CFDPSHTRVAGLNTKFLHYGLLVILALVIISAMQVVGVILVVAMLITPGITGYILAKRF
FT                   DYMMLIAVCTAVFSGIFGVLLSFHFNVATGPCIILLQASLFLCALGYSKYIAMRVVNI"
     MFNTIVAWFT EPLVYPFMQQ AIIIAPIIGA VCAILSCYLV LKGWSLMGDA ISHAVLPGII        60
     LAYVLAIPIA IGAFWAGIFC AVSVGYLRDN SRIKEDTVMG IVFSGMFAFG LVLFSKVETD       120
     QHLMHILFGN ILGIIKQEFW QSIGIALLAF ILIALKRKDL LLYCFDPSHT RVAGLNTKFL       180
     HYGLLVILAL VIISAMQVVG VILVVAMLIT PGITGYILAK RFDYMMLIAV CTAVFSGIFG       240
     VLLSFHFNVA TGPCIILLQA SLFLCALGYS KYIAMRVVNI                             280
//

If you have problems or comments...

PBIL Back to PBIL home page