(data stored in ACNUC7421 zone)

EMBL: CP000947.PE193

CP000947.PE193       Location/Qualifiers
FT   CDS             complement(206856..207746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0197"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; KEGG: hso:HS_0326 chelated iron ABC transporter,
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31765"
FT                   /db_xref="GOA:B0UVQ6"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ6"
FT                   /protein_id="ACA31765.1"
FT                   /translation="MLELLLEPFSYDFMFKAIVVSGAIGAVCAFLSAYLMLKGWSLIGD
FT                   ALSHAVVPGVAIAYALALPYAVGAFFSGLLATIAILAVKYVTKLKEDAVIGFIFTSFFA
FT                   LGLLIISINPTSVNVQSIVLGNILGIADEDMIQVAIILGISFVLLLLFWKDLMLVFFDE
FT                   IQAKAVGLSPLKFKILFFTLLSACIVTALQGVGAILVIAMVITPGATAYLLTDRFDRLL
FT                   IISILLGGTTSSLGAYLSYFADSATGGFIVSLQTFIFLLAFFFAPKYGLIPRKRSTQKA
FT                   VTSSPNLANQEKPNV"
     MLELLLEPFS YDFMFKAIVV SGAIGAVCAF LSAYLMLKGW SLIGDALSHA VVPGVAIAYA        60
     LALPYAVGAF FSGLLATIAI LAVKYVTKLK EDAVIGFIFT SFFALGLLII SINPTSVNVQ       120
     SIVLGNILGI ADEDMIQVAI ILGISFVLLL LFWKDLMLVF FDEIQAKAVG LSPLKFKILF       180
     FTLLSACIVT ALQGVGAILV IAMVITPGAT AYLLTDRFDR LLIISILLGG TTSSLGAYLS       240
     YFADSATGGF IVSLQTFIFL LAFFFAPKYG LIPRKRSTQK AVTSSPNLAN QEKPNV           296
//

If you have problems or comments...

PBIL Back to PBIL home page