(data stored in ACNUC7421 zone)

EMBL: CP000947.PE194

CP000947.PE194       Location/Qualifiers
FT   CDS             complement(207751..208509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0198"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hso:HS_0327 iron ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31776"
FT                   /db_xref="GOA:B0UVQ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ7"
FT                   /protein_id="ACA31776.1"
FT                   /translation="MKTHISSLSVRDITVRYSNGHTALHDVSFHLEGGTICALLGINGS
FT                   GKSTLFKSIMGLVKPQGSIEICNMPANQALKQNLVAYVPQSEEVDWQFPVSVYDVVMMG
FT                   RYGYMNCFRMPKAQDKKKVLDAMERVNIAHLRDRQIGELSGGQKKRVFLARALAQESQI
FT                   ILLDEPFTGVDVGTENAIIALLKQLRQEGHLVLVSTHNLSTVPSFCDQAVMINRTLLAA
FT                   GSIESTFTQENLTRVFGGVLRYQHFIQDAE"
     MKTHISSLSV RDITVRYSNG HTALHDVSFH LEGGTICALL GINGSGKSTL FKSIMGLVKP        60
     QGSIEICNMP ANQALKQNLV AYVPQSEEVD WQFPVSVYDV VMMGRYGYMN CFRMPKAQDK       120
     KKVLDAMERV NIAHLRDRQI GELSGGQKKR VFLARALAQE SQIILLDEPF TGVDVGTENA       180
     IIALLKQLRQ EGHLVLVSTH NLSTVPSFCD QAVMINRTLL AAGSIESTFT QENLTRVFGG       240
     VLRYQHFIQD AE                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page