(data stored in ACNUC7421 zone)

EMBL: CP000947.PE195

CP000947.PE195       Location/Qualifiers
FT   CDS             complement(208519..209400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0199"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   hso:HS_0328 chelated iron ABC transporter,
FT                   periplasmic-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31787"
FT                   /db_xref="GOA:B0UVQ8"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ8"
FT                   /protein_id="ACA31787.1"
FT                   /translation="MSRLLIVMGVILGSVFSLPSYAKFKVVTTFTVIQDIAQNVAGDAA
FT                   VVESITEPGAEIHDYEPTPQDIVKAQSADLVLWNGMNLERWFERFFTQVKDKPAVVVTK
FT                   GIDPISIYEGPYKGMPNPHAWMSTKNALVYIENIREALVKYDPKNADTYNANAKAYADK
FT                   IVALDAPLRAELEKVPASQRWLVTSEGAFSYLAHDYGFKELYLWPINAEEQGTPKQIKN
FT                   VIKKVREHKIPVVFSESTISDKPAKQVAKETNAKYGGVLYVDSLSTKDGKVPTYIDLLN
FT                   VTVSTIVNGFKK"
     MSRLLIVMGV ILGSVFSLPS YAKFKVVTTF TVIQDIAQNV AGDAAVVESI TEPGAEIHDY        60
     EPTPQDIVKA QSADLVLWNG MNLERWFERF FTQVKDKPAV VVTKGIDPIS IYEGPYKGMP       120
     NPHAWMSTKN ALVYIENIRE ALVKYDPKNA DTYNANAKAY ADKIVALDAP LRAELEKVPA       180
     SQRWLVTSEG AFSYLAHDYG FKELYLWPIN AEEQGTPKQI KNVIKKVREH KIPVVFSEST       240
     ISDKPAKQVA KETNAKYGGV LYVDSLSTKD GKVPTYIDLL NVTVSTIVNG FKK              293
//

If you have problems or comments...

PBIL Back to PBIL home page