(data stored in ACNUC7421 zone)

EMBL: CP000947.PE196

CP000947.PE196       Location/Qualifiers
FT   CDS             complement(209506..209835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0200"
FT                   /product="DsrC family protein"
FT                   /note="PFAM: DsrC family protein; KEGG: hso:HS_0329 sulfite
FT                   reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31800"
FT                   /db_xref="GOA:B0UVQ9"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ9"
FT                   /protein_id="ACA31800.1"
FT                   /translation="MLSVNQVQIETDVEGYLLDMNQWNKDVAIAIAKSENIELTEAHWE
FT                   IINFVRDFYQEYKTSPAMRMLVKALGQKLGADKGNSRYIQRLFPEGPAKQASKLAGLPK
FT                   PIKCL"
     MLSVNQVQIE TDVEGYLLDM NQWNKDVAIA IAKSENIELT EAHWEIINFV RDFYQEYKTS        60
     PAMRMLVKAL GQKLGADKGN SRYIQRLFPE GPAKQASKLA GLPKPIKCL                   109
//

If you have problems or comments...

PBIL Back to PBIL home page