(data stored in ACNUC7421 zone)

EMBL: CP000947.PE197

CP000947.PE197       Location/Qualifiers
FT   CDS             complement(209913..210575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0201"
FT                   /product="protein of unknown function UPF0005"
FT                   /note="PFAM: protein of unknown function UPF0005; KEGG:
FT                   hso:HS_0330 conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31811"
FT                   /db_xref="GOA:B0UVR0"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVR0"
FT                   /protein_id="ACA31811.1"
FT                   /translation="MQSRFIVDTKEESVLATNKVLRNTYFLLALTLAFSSVVAFSAMQL
FT                   NLPPLHFGVMLIGFYGLLFLNNMLANSAWGLLSTFALTGLLGYSLGPILSYYVGSGLGD
FT                   LVVLALAGTASVFFTCSAYVLTTKKDMSFLSGMMLALFIVLVIGMIASFFFNMSGFHIV
FT                   FSSLFIVFSTMAILYETSNIIHGGETNYIRATVSLYVSLYNLFVSLLNLLGIFNRDE"
     MQSRFIVDTK EESVLATNKV LRNTYFLLAL TLAFSSVVAF SAMQLNLPPL HFGVMLIGFY        60
     GLLFLNNMLA NSAWGLLSTF ALTGLLGYSL GPILSYYVGS GLGDLVVLAL AGTASVFFTC       120
     SAYVLTTKKD MSFLSGMMLA LFIVLVIGMI ASFFFNMSGF HIVFSSLFIV FSTMAILYET       180
     SNIIHGGETN YIRATVSLYV SLYNLFVSLL NLLGIFNRDE                             220
//

If you have problems or comments...

PBIL Back to PBIL home page