(data stored in ACNUC7421 zone)

EMBL: CP000947.PE198

CP000947.PE198       Location/Qualifiers
FT   CDS             complement(210983..212512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0202"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   hso:HS_0331 competence-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31822"
FT                   /db_xref="GOA:B0UVR1"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVR1"
FT                   /protein_id="ACA31822.1"
FT                   /translation="MSLAVVYSRASMGVQAPLVTIEVHLSNGKPAFTLVGLPEKTVTEA
FT                   QGRVRSALLNAQFKYPAKRITVNLAPADLPKEGGRFDLPIALGILAASEQINAKKLQQF
FT                   EFVAELALTGELRGVHGVIPAILAGQKSKRQLIVAQQNANEASLVSQHETFFARNLLEV
FT                   VQFLNDDSSLPSSTTLCMQSAVDFSPQSNKDLTDIIGQQHAKRALMIAAAGQHNLLFLG
FT                   PPGTGKTMLASRLTGLLPDMTDQEAIETASVTSLVQNELNFQNWKQRPFRAPHHSASSP
FT                   ALVGGGTIPKPGEISLAHNGVLFLDELPEFERRVLDALRQPLESGEIIISRANAKIQFP
FT                   ARFQLVAAMNPSPTGHYTGIHNRTSPQQVLRYLNRLSGPFLDRFDLSIEVPLLPQGALQ
FT                   NTEDRGETTAQVKEKVLRVREIQLARAGKVNAYLTGKEIERDCKLTEQDALFLENTLTR
FT                   LGLSVRAYHRILKVARTIADLNGDSDIKQNHLAEALSYRAMDRLLRKLSDQ"
     MSLAVVYSRA SMGVQAPLVT IEVHLSNGKP AFTLVGLPEK TVTEAQGRVR SALLNAQFKY        60
     PAKRITVNLA PADLPKEGGR FDLPIALGIL AASEQINAKK LQQFEFVAEL ALTGELRGVH       120
     GVIPAILAGQ KSKRQLIVAQ QNANEASLVS QHETFFARNL LEVVQFLNDD SSLPSSTTLC       180
     MQSAVDFSPQ SNKDLTDIIG QQHAKRALMI AAAGQHNLLF LGPPGTGKTM LASRLTGLLP       240
     DMTDQEAIET ASVTSLVQNE LNFQNWKQRP FRAPHHSASS PALVGGGTIP KPGEISLAHN       300
     GVLFLDELPE FERRVLDALR QPLESGEIII SRANAKIQFP ARFQLVAAMN PSPTGHYTGI       360
     HNRTSPQQVL RYLNRLSGPF LDRFDLSIEV PLLPQGALQN TEDRGETTAQ VKEKVLRVRE       420
     IQLARAGKVN AYLTGKEIER DCKLTEQDAL FLENTLTRLG LSVRAYHRIL KVARTIADLN       480
     GDSDIKQNHL AEALSYRAMD RLLRKLSDQ                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page