(data stored in ACNUC7421 zone)

EMBL: CP000947.PE199

CP000947.PE199       Location/Qualifiers
FT   CDS             complement(212614..213309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0203"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   hso:HS_0332 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31825"
FT                   /db_xref="GOA:B0UW08"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW08"
FT                   /protein_id="ACA31825.1"
FT                   /translation="MYKKMSWLLLVFHNAIFPIGNDLSENKMTNIKLNYHKTHFLMSAP
FT                   NIQVLPEDSGIEIAFAGRSNAGKSTALNALTQQKNLARTSKTPGRTQLINLFQVEPNCK
FT                   LVDLPGYGYAAVPEQMKLQWQKSLGEYLQKRECLGGLVILMDIRHPLKDLDQQMIEWAV
FT                   SADLPVLLLLTKADKLSQSARSKQVKMVRESILPFQGDVQVEAFSAQNKIGIERLSEKL
FT                   DQWFSPLFS"
     MYKKMSWLLL VFHNAIFPIG NDLSENKMTN IKLNYHKTHF LMSAPNIQVL PEDSGIEIAF        60
     AGRSNAGKST ALNALTQQKN LARTSKTPGR TQLINLFQVE PNCKLVDLPG YGYAAVPEQM       120
     KLQWQKSLGE YLQKRECLGG LVILMDIRHP LKDLDQQMIE WAVSADLPVL LLLTKADKLS       180
     QSARSKQVKM VRESILPFQG DVQVEAFSAQ NKIGIERLSE KLDQWFSPLF S                231
//

If you have problems or comments...

PBIL Back to PBIL home page