(data stored in ACNUC7421 zone)

EMBL: CP000947.PE2

CP000947.PE2         Location/Qualifiers
FT   CDS             1658..2758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; KEGG: hso:HS_0137 DNA-directed
FT                   DNA polymerase, beta subunit (DNA polymerase III, beta
FT                   subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31798"
FT                   /db_xref="GOA:B0UUL9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUL9"
FT                   /protein_id="ACA31798.1"
FT                   /translation="MQFIVSREHLLKPLQQVCGVLSSRPNFPILNNVLLQIEGNVLRIT
FT                   GTDLEVELSTQAQLIQASQDGSYTIPAKKFLDICRSFPDEAEITVIFEEERALVRSGRS
FT                   KFNLTALPADEYPNLADWQSEVDFYLPQSTLRRLIEATQFSMANQDARYFLNGMKFETE
FT                   GNLLRTVATDGHRLAVCTIPLEQDLHTHAVILPRKGILELMRLLENSEHAAHVQIGTNN
FT                   LRIDLGSIIFTSKLIDGRFPDYRRVLPRNATHIMEGNWELLKQAFARMAILSSDKVKTV
FT                   RLQLTSNQLKITATNPEQEVAEEILDVIYNGADMEVGFNVSYILDVLNALKCQQVRLCF
FT                   TDASSSCLLEDADDESAEYVVMPMRL"
     MQFIVSREHL LKPLQQVCGV LSSRPNFPIL NNVLLQIEGN VLRITGTDLE VELSTQAQLI        60
     QASQDGSYTI PAKKFLDICR SFPDEAEITV IFEEERALVR SGRSKFNLTA LPADEYPNLA       120
     DWQSEVDFYL PQSTLRRLIE ATQFSMANQD ARYFLNGMKF ETEGNLLRTV ATDGHRLAVC       180
     TIPLEQDLHT HAVILPRKGI LELMRLLENS EHAAHVQIGT NNLRIDLGSI IFTSKLIDGR       240
     FPDYRRVLPR NATHIMEGNW ELLKQAFARM AILSSDKVKT VRLQLTSNQL KITATNPEQE       300
     VAEEILDVIY NGADMEVGFN VSYILDVLNA LKCQQVRLCF TDASSSCLLE DADDESAEYV       360
     VMPMRL                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page