(data stored in ACNUC7421 zone)

EMBL: CP000947.PE20

CP000947.PE20        Location/Qualifiers
FT   CDS             complement(16560..17357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0020"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="TIGRFAM: serine O-acetyltransferase; PFAM:
FT                   transferase hexapeptide repeat containing protein; serine
FT                   acetyltransferase domain protein; KEGG: hso:HS_0154 serine
FT                   O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31799"
FT                   /db_xref="GOA:B0UUX8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX8"
FT                   /protein_id="ACA31799.1"
FT                   /translation="MSIEVWSLIRAEAAKLAENEPMLASFFHATILKHNNLGSALSYIL
FT                   ANKLANPIMPAIALREIIEEAHQNQPQIIESAACDIRAVRHRDPAVEQYSTPLLYLKGF
FT                   HALQSYRITHYLWQQGRKALAIYLQNQISVAFDVDIHPAARIGCGIMFDHATGIVIGET
FT                   SVIENDVSILQGVTLGGTGKESGDRHPKIREGVMIGSGAKVLGNIEIGRYAKIGANSVV
FT                   LQFVSEYTTVAGVPSQIVGKNKGAKPAFDMDQYFIDDAINLNI"
     MSIEVWSLIR AEAAKLAENE PMLASFFHAT ILKHNNLGSA LSYILANKLA NPIMPAIALR        60
     EIIEEAHQNQ PQIIESAACD IRAVRHRDPA VEQYSTPLLY LKGFHALQSY RITHYLWQQG       120
     RKALAIYLQN QISVAFDVDI HPAARIGCGI MFDHATGIVI GETSVIENDV SILQGVTLGG       180
     TGKESGDRHP KIREGVMIGS GAKVLGNIEI GRYAKIGANS VVLQFVSEYT TVAGVPSQIV       240
     GKNKGAKPAF DMDQYFIDDA INLNI                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page