(data stored in ACNUC7421 zone)

EMBL: CP000947.PE200

CP000947.PE200       Location/Qualifiers
FT   CDS             complement(213230..214612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0204"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.3.1.157"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: transferase hexapeptide repeat containing protein;
FT                   Nucleotidyl transferase; KEGG: hso:HS_0333
FT                   UDP-N-acetylglucosamine diphosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31826"
FT                   /db_xref="GOA:B0UW09"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW09"
FT                   /protein_id="ACA31826.1"
FT                   /translation="MTKRKFIMNKLSVVILAAGKGTRMYSDLPKVLHKIAGKPMVKHVI
FT                   DTAKKLSAAQIHLIYGHGADLLKQHLADEPVNWVFQSEQLGTGHAMQQAVPFFQDDENI
FT                   VMLYGDVPLISKETLECLISQKPENGIALLTVNLDNPTGYGRVIRENGTVTAIVEQKDA
FT                   NPEQLKITEVNTGVMVSDGASFRKWLARLDNNNAQGEYYMTDVIGLANQDGFKVVAVQA
FT                   KDLMEVEGVNNRLQLANLERHYQRKQVEKLLLAGVTFADPARFDLRGELTHGKDVEIDI
FT                   NVIIEGTVRLGNNVFIGAGCVLKNCTIADNVEIKPYSVIEDAIVGNNAKIGPFSRLRPG
FT                   AELSENTHVGNFVEIKKAQIGKGSKVNHLTYIGDAEVGHHCNIGAGVITCNYDGANKFK
FT                   TLIGDNVFVGSDSQLVAPLTIASGATIGAGTTVTKDVQENELVITRVPQRHISNWQRPK
FT                   RK"
     MTKRKFIMNK LSVVILAAGK GTRMYSDLPK VLHKIAGKPM VKHVIDTAKK LSAAQIHLIY        60
     GHGADLLKQH LADEPVNWVF QSEQLGTGHA MQQAVPFFQD DENIVMLYGD VPLISKETLE       120
     CLISQKPENG IALLTVNLDN PTGYGRVIRE NGTVTAIVEQ KDANPEQLKI TEVNTGVMVS       180
     DGASFRKWLA RLDNNNAQGE YYMTDVIGLA NQDGFKVVAV QAKDLMEVEG VNNRLQLANL       240
     ERHYQRKQVE KLLLAGVTFA DPARFDLRGE LTHGKDVEID INVIIEGTVR LGNNVFIGAG       300
     CVLKNCTIAD NVEIKPYSVI EDAIVGNNAK IGPFSRLRPG AELSENTHVG NFVEIKKAQI       360
     GKGSKVNHLT YIGDAEVGHH CNIGAGVITC NYDGANKFKT LIGDNVFVGS DSQLVAPLTI       420
     ASGATIGAGT TVTKDVQENE LVITRVPQRH ISNWQRPKRK                             460
//

If you have problems or comments...

PBIL Back to PBIL home page