(data stored in ACNUC7421 zone)

EMBL: CP000947.PE201

CP000947.PE201       Location/Qualifiers
FT   CDS             214658..215815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0205"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   hso:HS_0334 possible molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31827"
FT                   /db_xref="GOA:B0UW10"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW10"
FT                   /protein_id="ACA31827.1"
FT                   /translation="MLLCLANIRSSFMQKNNHYYIGIMSGTSLDGVDIALMDFNQRPPK
FT                   LLASHCFSMPENLRQQLTALLKNGEIGLQQLGELDHQLGLLYANSVQRFLAQNQMTADS
FT                   IQAIGCHGQTIWHSPQGQYPFTMQIGDANLISVLTGITTIADFRRKDMAHGGQGAPLSP
FT                   AFHQALFAQPDRITVVLNIGGISNISCLIPEQEVIGYDTGVGNALMDSWIEQHLGVPFD
FT                   QDGEWAKSGSVHQDLLKDLLDEPFFQQLPPKSTGRELFNLAWLNKKLKKHTALSAQDVQ
FT                   ATLLEFTVQCTVQELVKLTNPNHLPCLLLVCGGGAKNRQLMARLQACLPQWHVATTTEH
FT                   GLSVDYVEAAAFAWLAYQRINHLPSNLPSVTGAKSAVSLGVIYPK"
     MLLCLANIRS SFMQKNNHYY IGIMSGTSLD GVDIALMDFN QRPPKLLASH CFSMPENLRQ        60
     QLTALLKNGE IGLQQLGELD HQLGLLYANS VQRFLAQNQM TADSIQAIGC HGQTIWHSPQ       120
     GQYPFTMQIG DANLISVLTG ITTIADFRRK DMAHGGQGAP LSPAFHQALF AQPDRITVVL       180
     NIGGISNISC LIPEQEVIGY DTGVGNALMD SWIEQHLGVP FDQDGEWAKS GSVHQDLLKD       240
     LLDEPFFQQL PPKSTGRELF NLAWLNKKLK KHTALSAQDV QATLLEFTVQ CTVQELVKLT       300
     NPNHLPCLLL VCGGGAKNRQ LMARLQACLP QWHVATTTEH GLSVDYVEAA AFAWLAYQRI       360
     NHLPSNLPSV TGAKSAVSLG VIYPK                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page