(data stored in ACNUC7421 zone)

EMBL: CP000947.PE202

CP000947.PE202       Location/Qualifiers
FT   CDS             215818..216729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0206"
FT                   /product="glucokinase regulatory-like protein"
FT                   /note="TIGRFAM: glucokinase regulatory-like protein; PFAM:
FT                   sugar isomerase (SIS); KEGG: hso:HS_0335 glucokinase
FT                   regulator-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31828"
FT                   /db_xref="GOA:B0UW11"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW11"
FT                   /protein_id="ACA31828.1"
FT                   /translation="MNKQNLINQFAQLITEQPNPLSVNLDQMSALEIVQLMNKEDQQVP
FT                   LVIAKALPEIAVVVEKIVAAFRQGGRLVYLGAGTSGRLGVLDASECPPTFGVNHEMVKG
FT                   IIAGGEQAIRYPVEGAEDNQQAAIVDLQAIQLCSKDILVGIAASGRTPYVISGLKYAKE
FT                   IGSFTVAIASNPQSAMAKIADIGIETIVGPEILTGSSRLKSGTAQKLVLNMLTTASMVL
FT                   LGKCYQNLMVDVQASNEKLVDRATRIIMQATGCERAKAEQTLTQADNNAKLAILMILMD
FT                   LDKQSAVDLLAKNQDKLRQTLD"
     MNKQNLINQF AQLITEQPNP LSVNLDQMSA LEIVQLMNKE DQQVPLVIAK ALPEIAVVVE        60
     KIVAAFRQGG RLVYLGAGTS GRLGVLDASE CPPTFGVNHE MVKGIIAGGE QAIRYPVEGA       120
     EDNQQAAIVD LQAIQLCSKD ILVGIAASGR TPYVISGLKY AKEIGSFTVA IASNPQSAMA       180
     KIADIGIETI VGPEILTGSS RLKSGTAQKL VLNMLTTASM VLLGKCYQNL MVDVQASNEK       240
     LVDRATRIIM QATGCERAKA EQTLTQADNN AKLAILMILM DLDKQSAVDL LAKNQDKLRQ       300
     TLD                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page