(data stored in ACNUC7421 zone)

EMBL: CP000947.PE204

CP000947.PE204       Location/Qualifiers
FT   CDS             217835..218533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31830"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW13"
FT                   /protein_id="ACA31830.1"
FT                   /translation="MRGGGGNFNFYGKAGIDLTSRFETMKITENHDSDRGFKLSIPASS
FT                   RQNTFSPSIFFETTYNILPQTEIGLGLGYIKRKGFDHIAIWPVEGSSLYNPQGQFHLKE
FT                   TYRVNRYASLPIYFILKQNYALNANTKFYLKGDLGYSINKIRKTVYTLYEDLSLGSSTG
FT                   YKKDRDFISNNKSRSGLYLGLGLGIEYKSFLVDIGYYHTHSKITYKEQGSYVSTPYNND
FT                   AIRLTLGFKF"
     MRGGGGNFNF YGKAGIDLTS RFETMKITEN HDSDRGFKLS IPASSRQNTF SPSIFFETTY        60
     NILPQTEIGL GLGYIKRKGF DHIAIWPVEG SSLYNPQGQF HLKETYRVNR YASLPIYFIL       120
     KQNYALNANT KFYLKGDLGY SINKIRKTVY TLYEDLSLGS STGYKKDRDF ISNNKSRSGL       180
     YLGLGLGIEY KSFLVDIGYY HTHSKITYKE QGSYVSTPYN NDAIRLTLGF KF               232
//

If you have problems or comments...

PBIL Back to PBIL home page