(data stored in ACNUC7421 zone)

EMBL: CP000947.PE206

CP000947.PE206       Location/Qualifiers
FT   CDS             220629..222389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0210"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: hso:HS_0339 conserved
FT                   outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31833"
FT                   /db_xref="GOA:B0UW15"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW15"
FT                   /protein_id="ACA31833.1"
FT                   /translation="MKLLSKYFVRSILNTSIFCIYLASSFSFAEHLVDLKVVGVTGVQK
FT                   TTNVDAYINTIDEEERDGSERYQQLVRTAIDKALRAYGYYSSTVNFTLQPAKSSNKPVL
FT                   VANVDMGRPSIIQRADVTILGEAKDDEVFQDLLRRTAQKGEHVSHPVYEDYKSRLQKQL
FT                   LARGYFDAKFEVSRFEIKPSTYQGWWKMVLNSGTRYKFGQFNFKHSQIREDYLRNMMPI
FT                   KTGDKYLINDLSSLTNDYTSSNWFRSVLLEPKVDEKRKVVDINVLLYPRKKNAIDVGIG
FT                   YSSDVGTRFKLSWIKPWINNRGHSFNSNLYISAPKQTLEANYKIPLLKNPQRYYYELSG
FT                   GFEKENTKDTQTIAASFAALRYWNRVTGWQHSFGLRVRYDSFTQANVSDRTLFIYPTIS
FT                   ANRTRLRGELFPTWGDSQRITVDFGSKRWKSDVNFFRIKASTVWIRTFKENHRFLTRGE
FT                   IGWLHTKDINKIPPALRFFAGGERSVRGYGYKKISPTSSDGKPIGAPYLLTVNTEYQYQ
FT                   VLEDWWLAAFADTGLAANKFNVKELRYGAGFGVRWVSPVGAIKLDIATPIRDREKNKNI
FT                   QFYIGLGSEL"
     MKLLSKYFVR SILNTSIFCI YLASSFSFAE HLVDLKVVGV TGVQKTTNVD AYINTIDEEE        60
     RDGSERYQQL VRTAIDKALR AYGYYSSTVN FTLQPAKSSN KPVLVANVDM GRPSIIQRAD       120
     VTILGEAKDD EVFQDLLRRT AQKGEHVSHP VYEDYKSRLQ KQLLARGYFD AKFEVSRFEI       180
     KPSTYQGWWK MVLNSGTRYK FGQFNFKHSQ IREDYLRNMM PIKTGDKYLI NDLSSLTNDY       240
     TSSNWFRSVL LEPKVDEKRK VVDINVLLYP RKKNAIDVGI GYSSDVGTRF KLSWIKPWIN       300
     NRGHSFNSNL YISAPKQTLE ANYKIPLLKN PQRYYYELSG GFEKENTKDT QTIAASFAAL       360
     RYWNRVTGWQ HSFGLRVRYD SFTQANVSDR TLFIYPTISA NRTRLRGELF PTWGDSQRIT       420
     VDFGSKRWKS DVNFFRIKAS TVWIRTFKEN HRFLTRGEIG WLHTKDINKI PPALRFFAGG       480
     ERSVRGYGYK KISPTSSDGK PIGAPYLLTV NTEYQYQVLE DWWLAAFADT GLAANKFNVK       540
     ELRYGAGFGV RWVSPVGAIK LDIATPIRDR EKNKNIQFYI GLGSEL                      586
//

If you have problems or comments...

PBIL Back to PBIL home page