(data stored in ACNUC7421 zone)

EMBL: CP000947.PE207

CP000947.PE207       Location/Qualifiers
FT   CDS             222400..225927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0211"
FT                   /product="protein of unknown function DUF490"
FT                   /note="PFAM: protein of unknown function DUF490; KEGG:
FT                   hso:HS_0340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31834"
FT                   /db_xref="GOA:B0UW16"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW16"
FT                   /protein_id="ACA31834.1"
FT                   /translation="MTQIPNENTTTERQETRSVKPKRKVLRWILCTISAVILLLILFLV
FT                   TALATNSGQRLLIQLADHFIDNLHIAQIDGGLQDGLQLKQIAFHTQGIKADIEQANIKL
FT                   DLHCLLSGKICLKDLTLNQPKIQIDTAQLPKSETKTSQPIQQIKLPVEVDINGIEINQL
FT                   DLTIDQQQVKLAKFRTALTLNNEQGLTLLPTEINGLTIVHRHLTEKTTKKKKSEKTVRS
FT                   PVDWEKLTQQLNQPLLPDMPEIELPFDLHIQGIQGKNWLYQQIGNSNIPQSDLHQIEIS
FT                   TIYLHADSIDNSIQLQTFQLESNLGQLRGEGTLRLKQEFPIELQVQATLNELKHDGKLL
FT                   LPHSNINFTLSGNLKKQTALFLQTQGTLESILQGKIELYSQKTPFDIELKVINGQYPFE
FT                   KNSTDPLKIQDMFFTAKGDLLNYQATLQGKLIGMGMPETNVDLVLQGGLTQFTLQQLRV
FT                   NALNMKANANANVSWKDKLKLKSNIDLKGHNVRLNNMRINKIDLLANISLQDIVQGQVD
FT                   LDIDGFSLNNIKLNSTKLQIKGTEQQHYLILKSKGEPASATLNLQGKFDRTLQQWQGIL
FT                   SQVNIHSLIGNLTNSENILLSYDNKKTIAQVSAHCWRSSDIHLCFQQEFIVGKTGEIPF
FT                   DFKTINLALVNKLISQEIFKGHLSGQGKFAWFTESSPYLTLQLKGDNLNVAKKLDYRTF
FT                   RLAIPTLNITTELQNNNLTLNSNFNIQNRGDVNMELKLADLTNQKRLSGHLKISDMNLN
FT                   IVNQLIASSEKVDGQVNAKLSFAGDLSNPLLNGEFAVSQVRAKLKSVPFGITNGNIILS
FT                   FYGDRSILKGNIQTHESHLNIEGQANWRKLDDWQAGLHINADKFKVDIPSIAKLQVSPN
FT                   IEIHATPKLLALSGNVDIPWARIEIERLPDNIVAPSKDEVILDGPQKTKVVKLMKGEIE
FT                   TTTKSGIQIHSDLKIKLGDHVRLEAYGLKTELNGLLSVKQEKGNLGLFGQINLHNGHYE
FT                   SFGQDLLIRKGIISFSGLPSQPMLNIEAIRNPTSMENTNMTVGAKIVGIADSPEITIFS
FT                   EPSTSQDQALSYLLTGRSLENSGNNGSGGSLGAALLGIGLAKSGKLVGGIGKVFGIQNL
FT                   NLDTSGVGDSSKVVVSGNITPTLQIKYGIGLFDGLAELTLRYRLLPKLYLQSVSGINQA
FT                   VDLLYQFEF"
     MTQIPNENTT TERQETRSVK PKRKVLRWIL CTISAVILLL ILFLVTALAT NSGQRLLIQL        60
     ADHFIDNLHI AQIDGGLQDG LQLKQIAFHT QGIKADIEQA NIKLDLHCLL SGKICLKDLT       120
     LNQPKIQIDT AQLPKSETKT SQPIQQIKLP VEVDINGIEI NQLDLTIDQQ QVKLAKFRTA       180
     LTLNNEQGLT LLPTEINGLT IVHRHLTEKT TKKKKSEKTV RSPVDWEKLT QQLNQPLLPD       240
     MPEIELPFDL HIQGIQGKNW LYQQIGNSNI PQSDLHQIEI STIYLHADSI DNSIQLQTFQ       300
     LESNLGQLRG EGTLRLKQEF PIELQVQATL NELKHDGKLL LPHSNINFTL SGNLKKQTAL       360
     FLQTQGTLES ILQGKIELYS QKTPFDIELK VINGQYPFEK NSTDPLKIQD MFFTAKGDLL       420
     NYQATLQGKL IGMGMPETNV DLVLQGGLTQ FTLQQLRVNA LNMKANANAN VSWKDKLKLK       480
     SNIDLKGHNV RLNNMRINKI DLLANISLQD IVQGQVDLDI DGFSLNNIKL NSTKLQIKGT       540
     EQQHYLILKS KGEPASATLN LQGKFDRTLQ QWQGILSQVN IHSLIGNLTN SENILLSYDN       600
     KKTIAQVSAH CWRSSDIHLC FQQEFIVGKT GEIPFDFKTI NLALVNKLIS QEIFKGHLSG       660
     QGKFAWFTES SPYLTLQLKG DNLNVAKKLD YRTFRLAIPT LNITTELQNN NLTLNSNFNI       720
     QNRGDVNMEL KLADLTNQKR LSGHLKISDM NLNIVNQLIA SSEKVDGQVN AKLSFAGDLS       780
     NPLLNGEFAV SQVRAKLKSV PFGITNGNII LSFYGDRSIL KGNIQTHESH LNIEGQANWR       840
     KLDDWQAGLH INADKFKVDI PSIAKLQVSP NIEIHATPKL LALSGNVDIP WARIEIERLP       900
     DNIVAPSKDE VILDGPQKTK VVKLMKGEIE TTTKSGIQIH SDLKIKLGDH VRLEAYGLKT       960
     ELNGLLSVKQ EKGNLGLFGQ INLHNGHYES FGQDLLIRKG IISFSGLPSQ PMLNIEAIRN      1020
     PTSMENTNMT VGAKIVGIAD SPEITIFSEP STSQDQALSY LLTGRSLENS GNNGSGGSLG      1080
     AALLGIGLAK SGKLVGGIGK VFGIQNLNLD TSGVGDSSKV VVSGNITPTL QIKYGIGLFD      1140
     GLAELTLRYR LLPKLYLQSV SGINQAVDLL YQFEF                                 1175
//

If you have problems or comments...

PBIL Back to PBIL home page