(data stored in ACNUC7421 zone)

EMBL: CP000947.PE21

CP000947.PE21        Location/Qualifiers
FT   CDS             complement(17359..18522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0021"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; KEGG: hso:HS_0155
FT                   glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31832"
FT                   /db_xref="GOA:B0UUX9"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX9"
FT                   /protein_id="ACA31832.1"
FT                   /translation="MPYLLSICNVNKHKRSQKLKKKKRKKFINLSGCCNNTLIFLLIPK
FT                   ILRKNMNDNSPSPTPITVIGAGAYGTALAIAFSRNGYPTYLWGHRPQHCQRLRNERKNQ
FT                   AFLPNIHFPDSLYVEDNLAQAIQHSRELLIVVPSHVFGDVIMQIKPHLRSDQRIAWATK
FT                   GLERNTGRLLQEVVEEHVGYGYPLAVLSGPTFAKELAAGMPTAITLASNNEQFALEFQE
FT                   RIHCSKFRVYVNQDMIGVQLGGAVKNVIAIAAGISDGMGFGANARTALITRGIAEISRL
FT                   GISLGANPNTFMGTSGLGDLVLTCTDNQSRNRRFGLMLGQGFDCTTAINELGPVIEGFY
FT                   NTKETFLLAQQQGVEMPITEQVYQILFCGKKPEDAAITLLGRKRKRE"
     MPYLLSICNV NKHKRSQKLK KKKRKKFINL SGCCNNTLIF LLIPKILRKN MNDNSPSPTP        60
     ITVIGAGAYG TALAIAFSRN GYPTYLWGHR PQHCQRLRNE RKNQAFLPNI HFPDSLYVED       120
     NLAQAIQHSR ELLIVVPSHV FGDVIMQIKP HLRSDQRIAW ATKGLERNTG RLLQEVVEEH       180
     VGYGYPLAVL SGPTFAKELA AGMPTAITLA SNNEQFALEF QERIHCSKFR VYVNQDMIGV       240
     QLGGAVKNVI AIAAGISDGM GFGANARTAL ITRGIAEISR LGISLGANPN TFMGTSGLGD       300
     LVLTCTDNQS RNRRFGLMLG QGFDCTTAIN ELGPVIEGFY NTKETFLLAQ QQGVEMPITE       360
     QVYQILFCGK KPEDAAITLL GRKRKRE                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page