(data stored in ACNUC7421 zone)

EMBL: CP000947.PE210

CP000947.PE210       Location/Qualifiers
FT   CDS             complement(229886..231130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0214"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="TIGRFAM: ATP-dependent Clp protease, ATP-binding
FT                   subunit ClpX; PFAM: AAA ATPase central domain protein; zinc
FT                   finger C4 domain protein; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: hso:HS_1433 ATP-dependent Clp
FT                   protease, ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31837"
FT                   /db_xref="GOA:B0UW19"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW19"
FT                   /protein_id="ACA31837.1"
FT                   /translation="MTKEKELHCSFCGKEQKEVDKLIAGTSGYICNECIELCHDMLANA
FT                   DDIEEIDEEFQEEEPKLPTPHEIRAHLDDYVIGQDYAKKVLAVAVYNHYKRLRSEKNTS
FT                   EVELGKSNILLIGPTGSGKTLLAQTLARMLNVPFAMADATTLTEAGYVGEDVENVLQKL
FT                   LQNCDYDIEKAQQGIIYIDEIDKITRKSENPSITRDVSGEGVQQALLKLVEGTVASIPP
FT                   QGGRKHPQQEMLRVDTSKILFICGGAFAGLDKIIEKRTNTSGKGIGFGADVRIDEEKVS
FT                   LTELFKQVEPDDLMKFGLIPEFIGRLPVIAPLSELDEEALVKILTEPKNALTKQYQVLF
FT                   SLENIELEFTQEALIAMAKKALARKTGARGLRSIVETLLLDTMYDLPSIENLQKVIVEE
FT                   ETVTENKVPVLKFNS"
     MTKEKELHCS FCGKEQKEVD KLIAGTSGYI CNECIELCHD MLANADDIEE IDEEFQEEEP        60
     KLPTPHEIRA HLDDYVIGQD YAKKVLAVAV YNHYKRLRSE KNTSEVELGK SNILLIGPTG       120
     SGKTLLAQTL ARMLNVPFAM ADATTLTEAG YVGEDVENVL QKLLQNCDYD IEKAQQGIIY       180
     IDEIDKITRK SENPSITRDV SGEGVQQALL KLVEGTVASI PPQGGRKHPQ QEMLRVDTSK       240
     ILFICGGAFA GLDKIIEKRT NTSGKGIGFG ADVRIDEEKV SLTELFKQVE PDDLMKFGLI       300
     PEFIGRLPVI APLSELDEEA LVKILTEPKN ALTKQYQVLF SLENIELEFT QEALIAMAKK       360
     ALARKTGARG LRSIVETLLL DTMYDLPSIE NLQKVIVEEE TVTENKVPVL KFNS             414
//

If you have problems or comments...

PBIL Back to PBIL home page