(data stored in ACNUC7421 zone)

EMBL: CP000947.PE211

CP000947.PE211       Location/Qualifiers
FT   CDS             complement(231146..231727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0215"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="TIGRFAM: ATP-dependent Clp protease, proteolytic
FT                   subunit ClpP; PFAM: peptidase S14 ClpP; KEGG: hso:HS_1432
FT                   ATP-dependent Clp protease, proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31838"
FT                   /db_xref="GOA:B0UW20"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW20"
FT                   /protein_id="ACA31838.1"
FT                   /translation="MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLTGEVEDRMANLIV
FT                   AQLLFLEAEDPAKDINIYINSPGGSVTAGMAIYDTMQFIKPNVRTLCIGQACSMGAFLL
FT                   AGGTAGKRAALPHARVMIHQPLGGFRGQASDIQIHAQEILKIKQTLNERLAFHTGQSIE
FT                   QIEQDTDRDNFMSAEQAKLYGLVDDVLIKR"
     MSVIPMVVEQ TSRGERSYDI YSRLLKERVI FLTGEVEDRM ANLIVAQLLF LEAEDPAKDI        60
     NIYINSPGGS VTAGMAIYDT MQFIKPNVRT LCIGQACSMG AFLLAGGTAG KRAALPHARV       120
     MIHQPLGGFR GQASDIQIHA QEILKIKQTL NERLAFHTGQ SIEQIEQDTD RDNFMSAEQA       180
     KLYGLVDDVL IKR                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page