(data stored in ACNUC7421 zone)

EMBL: CP000947.PE212

CP000947.PE212       Location/Qualifiers
FT   CDS             complement(231813..233111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0216"
FT                   /product="trigger factor"
FT                   /note="TIGRFAM: trigger factor; PFAM: peptidylprolyl
FT                   isomerase FKBP-type; trigger factor domain protein; trigger
FT                   factor domain; KEGG: hso:HS_1431 FKBP-type peptidyl-prolyl
FT                   cis-trans isomerase, trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31839"
FT                   /db_xref="GOA:B0UW21"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW21"
FT                   /protein_id="ACA31839.1"
FT                   /translation="MSFNIETTQGLERRVNITVPSEAVEQAVREELKRVAKNARIDGFR
FT                   KGKVPAQMIEKRFGASVRQDVLGDLLQKHFFNVMLENKVNLAGRPEFTVEQFEAGKELK
FT                   FTATFEVYPEVQLQGLDKIKVEKPVVEISDADIDKMLDILRKQQATWIETQDVAKADDR
FT                   VTIDFVGSVDGEEFEGGKSTDFVLAMGQGRMIPGFEEGIIGHKAGEQFEINVTFPETYH
FT                   AENLKGKAAKFSITLKKVEVMQLPELTDEFVAKFGPNTKNVADLRNEIAKNMQRELKNA
FT                   LVSRIKTQVIDGLLEQNPIEVPTAAVEQEIEVLRNQAAQRFGGNAQQAAQLPRELFEEQ
FT                   AKRRVQVGLLFSEVISSNELKADEERVKAMIADIASAYEQPAEVIEYYSKNKELMNNIR
FT                   NVVLEQQAVDAVLTKAQVTEKASSFDEVMNPQA"
     MSFNIETTQG LERRVNITVP SEAVEQAVRE ELKRVAKNAR IDGFRKGKVP AQMIEKRFGA        60
     SVRQDVLGDL LQKHFFNVML ENKVNLAGRP EFTVEQFEAG KELKFTATFE VYPEVQLQGL       120
     DKIKVEKPVV EISDADIDKM LDILRKQQAT WIETQDVAKA DDRVTIDFVG SVDGEEFEGG       180
     KSTDFVLAMG QGRMIPGFEE GIIGHKAGEQ FEINVTFPET YHAENLKGKA AKFSITLKKV       240
     EVMQLPELTD EFVAKFGPNT KNVADLRNEI AKNMQRELKN ALVSRIKTQV IDGLLEQNPI       300
     EVPTAAVEQE IEVLRNQAAQ RFGGNAQQAA QLPRELFEEQ AKRRVQVGLL FSEVISSNEL       360
     KADEERVKAM IADIASAYEQ PAEVIEYYSK NKELMNNIRN VVLEQQAVDA VLTKAQVTEK       420
     ASSFDEVMNP QA                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page