(data stored in ACNUC7421 zone)

EMBL: CP000947.PE213

CP000947.PE213       Location/Qualifiers
FT   CDS             233470..234885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0217"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; General
FT                   secretory system II protein E domain protein; KEGG:
FT                   hso:HS_1430 pilin/fimbriae biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31840"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW22"
FT                   /protein_id="ACA31840.1"
FT                   /translation="MIIPQSEDMSPIVMSIDGDTYEITPHLWQRNQQQSQILLRYFAIP
FT                   LQENEQTLWLGVDSLNNISACETFAFLYGKIVEPVLLNNQLLKQLLQNLSPQQNNMFVE
FT                   EQPINQYVAEHRIEVTEKSDEPVIQLLDHIFENALKQHVSDIHIEPQMNCLQIRFRIDG
FT                   ILQCQSPLPLSLSKRILSRLKLLAKLDISETRLPQDGRFHFKTTFSDILDFRLSTLPTN
FT                   MGEKAVLRLQQNKPVQLSFAELGMTENQQKSFKQALSQPQGLILVTGPTGSGKSISLYT
FT                   ALQWLNDKHKHIMTAEDPIEIELNGIIQCQINPQIGLDFSRLLRTFLRQDPDIIMLGEI
FT                   RDNESAIMALRAAQTGHLVLSTLHTNDAPSAVSRLLQLGVKQHEIDNSLLLVIAQRLVR
FT                   KKCPHTENENCTCHQKYQGRIGVYQFLQPHLIDNHICYQTDYAHLRESAMEKVRLEITD
FT                   LAEVDRVIGQSSE"
     MIIPQSEDMS PIVMSIDGDT YEITPHLWQR NQQQSQILLR YFAIPLQENE QTLWLGVDSL        60
     NNISACETFA FLYGKIVEPV LLNNQLLKQL LQNLSPQQNN MFVEEQPINQ YVAEHRIEVT       120
     EKSDEPVIQL LDHIFENALK QHVSDIHIEP QMNCLQIRFR IDGILQCQSP LPLSLSKRIL       180
     SRLKLLAKLD ISETRLPQDG RFHFKTTFSD ILDFRLSTLP TNMGEKAVLR LQQNKPVQLS       240
     FAELGMTENQ QKSFKQALSQ PQGLILVTGP TGSGKSISLY TALQWLNDKH KHIMTAEDPI       300
     EIELNGIIQC QINPQIGLDF SRLLRTFLRQ DPDIIMLGEI RDNESAIMAL RAAQTGHLVL       360
     STLHTNDAPS AVSRLLQLGV KQHEIDNSLL LVIAQRLVRK KCPHTENENC TCHQKYQGRI       420
     GVYQFLQPHL IDNHICYQTD YAHLRESAME KVRLEITDLA EVDRVIGQSS E                471
//

If you have problems or comments...

PBIL Back to PBIL home page