(data stored in ACNUC7421 zone)

EMBL: CP000947.PE214

CP000947.PE214       Location/Qualifiers
FT   CDS             complement(234919..236178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0218"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: hso:HS_1429 possible transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31841"
FT                   /db_xref="GOA:B0UW23"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW23"
FT                   /protein_id="ACA31841.1"
FT                   /translation="MDSIPLSTLFITLIILLILSAYFSGSETGVLSVNRYRMRFLAEKG
FT                   HKGAQKTEKLLKRTDVFLSLILICNNLVNISASAIATIIGMRIYGDVGVAVATGLLTFV
FT                   MLIFSEIFPKTIAALYPEKVAFVSSHIISILLKIFSPLVFIINLFISGLMKLFRLKNEV
FT                   KAHSLNSEELRAIVNQSGQYIPSAHQEMLLSILDLEKVTVDDIMVPRNDIAGIDVDDDW
FT                   KAIMRQLNHAAHGRVVLYKGSIDENVLGILRVREAYRLMLDKNEFSKETLIRAVDETYF
FT                   IPEGTELNTQLLNFRNNKERIGLVVDEYGDIKGLVTLEDILEEIVGEFTTSTAPSIDEE
FT                   VTQQSDGTIIIEGSANLRDLNKLFNWNLDTEDARTFNGLILEHLEEIPNEGTECEINGL
FT                   KITVLEVADNMIKQVKVEKV"
     MDSIPLSTLF ITLIILLILS AYFSGSETGV LSVNRYRMRF LAEKGHKGAQ KTEKLLKRTD        60
     VFLSLILICN NLVNISASAI ATIIGMRIYG DVGVAVATGL LTFVMLIFSE IFPKTIAALY       120
     PEKVAFVSSH IISILLKIFS PLVFIINLFI SGLMKLFRLK NEVKAHSLNS EELRAIVNQS       180
     GQYIPSAHQE MLLSILDLEK VTVDDIMVPR NDIAGIDVDD DWKAIMRQLN HAAHGRVVLY       240
     KGSIDENVLG ILRVREAYRL MLDKNEFSKE TLIRAVDETY FIPEGTELNT QLLNFRNNKE       300
     RIGLVVDEYG DIKGLVTLED ILEEIVGEFT TSTAPSIDEE VTQQSDGTII IEGSANLRDL       360
     NKLFNWNLDT EDARTFNGLI LEHLEEIPNE GTECEINGLK ITVLEVADNM IKQVKVEKV        419
//

If you have problems or comments...

PBIL Back to PBIL home page