(data stored in ACNUC7421 zone)

EMBL: CP000947.PE215

CP000947.PE215       Location/Qualifiers
FT   CDS             complement(236248..237045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0219"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   hso:HS_1428 possible permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31842"
FT                   /db_xref="GOA:B0UW24"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW24"
FT                   /protein_id="ACA31842.1"
FT                   /translation="MWFAVISAFFYLISILLIMPMLLGQGGQEVKLNKMAFLVTALIAI
FT                   ISHFIALNKLFIHLFIGNNFTLIEICSLVSAMIAAIATVAILARVKTLWFLLPIVYCFS
FT                   IINLILQALLPEIWVYHLSQNTSLLFHIALSLFAYSVCFIAMLYAIQLRWIDNSLKSKK
FT                   LTFSPVVPPLMTVEKHFFRSLFSGQILLTLTLISGSIQLIDFFSAHNIPKAIFSFLAWF
FT                   VFGIALFGHWKLYWRGKRMIIYTISGMILLTVAYFGSRVILEL"
     MWFAVISAFF YLISILLIMP MLLGQGGQEV KLNKMAFLVT ALIAIISHFI ALNKLFIHLF        60
     IGNNFTLIEI CSLVSAMIAA IATVAILARV KTLWFLLPIV YCFSIINLIL QALLPEIWVY       120
     HLSQNTSLLF HIALSLFAYS VCFIAMLYAI QLRWIDNSLK SKKLTFSPVV PPLMTVEKHF       180
     FRSLFSGQIL LTLTLISGSI QLIDFFSAHN IPKAIFSFLA WFVFGIALFG HWKLYWRGKR       240
     MIIYTISGMI LLTVAYFGSR VILEL                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page