(data stored in ACNUC7421 zone)

EMBL: CP000947.PE216

CP000947.PE216       Location/Qualifiers
FT   CDS             237195..238571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0220"
FT                   /product="signal recognition particle protein"
FT                   /note="TIGRFAM: signal recognition particle protein; PFAM:
FT                   GTP-binding signal recognition particle SRP54 G- domain;
FT                   Signal peptide binding (SRP54) M- domain protein;
FT                   GTP-binding signal recognition particle SRP54 helical
FT                   bundle; SMART: AAA ATPase; KEGG: hso:HS_1427 signal
FT                   recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31844"
FT                   /db_xref="GOA:B0UW25"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW25"
FT                   /protein_id="ACA31844.1"
FT                   /translation="MFENLSDRLSKTLRNITGKGRLTEDNIKDTLREVRMALLEADVAL
FT                   PVVREFIHQVKERAIGEEVNKSLTPGQEFLKIVQTELEKAMGVANEKLNLATQPPAVIL
FT                   MAGLQGAGKTTSVGKLAKFLKENYKKKIMVVSVDVYRPAAIKQLETLAQSIGVDFYPSN
FT                   VSQKPVEIARTALAEAKLKFYDVLIVDTAGRLHVDDTMMEEIQQIHTALNPIETLFTVD
FT                   AMTGQDAANTAKAFNEALPLTGIILTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEA
FT                   LEPFHPDRIASRILGMGDVLSLIEDLQRSVDQEKAEKMAKKFKKGDSFTLEDFREQLIE
FT                   MKKMGGMMSMLEKLPGARNLPDHVKSQVDDKMFNKMEAIINSMTLKERANPDIIKGSRR
FT                   RRIALGSGTQVQDVNNLLRQFNEMQRMMKKMRKGGMARMMRGMQGMMGGLGGLGNMFRR
FT                   "
     MFENLSDRLS KTLRNITGKG RLTEDNIKDT LREVRMALLE ADVALPVVRE FIHQVKERAI        60
     GEEVNKSLTP GQEFLKIVQT ELEKAMGVAN EKLNLATQPP AVILMAGLQG AGKTTSVGKL       120
     AKFLKENYKK KIMVVSVDVY RPAAIKQLET LAQSIGVDFY PSNVSQKPVE IARTALAEAK       180
     LKFYDVLIVD TAGRLHVDDT MMEEIQQIHT ALNPIETLFT VDAMTGQDAA NTAKAFNEAL       240
     PLTGIILTKV DGDARGGAAL SIRHITGKPI KFLGVGEKTE ALEPFHPDRI ASRILGMGDV       300
     LSLIEDLQRS VDQEKAEKMA KKFKKGDSFT LEDFREQLIE MKKMGGMMSM LEKLPGARNL       360
     PDHVKSQVDD KMFNKMEAII NSMTLKERAN PDIIKGSRRR RIALGSGTQV QDVNNLLRQF       420
     NEMQRMMKKM RKGGMARMMR GMQGMMGGLG GLGNMFRR                               458
//

If you have problems or comments...

PBIL Back to PBIL home page