(data stored in ACNUC7421 zone)

EMBL: CP000947.PE22

CP000947.PE22        Location/Qualifiers
FT   CDS             complement(18437..18952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0022"
FT                   /product="protein-export protein SecB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: hso:HS_0156 protein-export
FT                   protein, subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31843"
FT                   /db_xref="GOA:B0UUY0"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUY0"
FT                   /protein_id="ACA31843.1"
FT                   /translation="MTEKNQDAVTEEQGTEVVLQIQRIYVKDVSFEAPNLPHIFQQEWK
FT                   PKLDFNLSTETTHLAEDLYEVCLNISVETTMEGSEDVAFICEVKQAGIFAISGLEDVQL
FT                   AHCLTSQCPNMLFPYARELISSLVNRGTFPALNLAPVNFDALFVEYMQRQQAQEESKTE
FT                   EKEKKEVH"
     MTEKNQDAVT EEQGTEVVLQ IQRIYVKDVS FEAPNLPHIF QQEWKPKLDF NLSTETTHLA        60
     EDLYEVCLNI SVETTMEGSE DVAFICEVKQ AGIFAISGLE DVQLAHCLTS QCPNMLFPYA       120
     RELISSLVNR GTFPALNLAP VNFDALFVEY MQRQQAQEES KTEEKEKKEV H                171
//

If you have problems or comments...

PBIL Back to PBIL home page