(data stored in ACNUC7421 zone)

EMBL: CP000947.PE220

CP000947.PE220       Location/Qualifiers
FT   CDS             243084..243500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0224"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   hso:HS_0666 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31848"
FT                   /db_xref="GOA:B0UW29"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW29"
FT                   /protein_id="ACA31848.1"
FT                   /translation="MKKETEIRRGRHVVFNLHVHLVFVTKYRGEVFTQAILNDLHTIFE
FT                   AVCADFEAKLVEFDGEDDHVHLLVEYPPKVAISNLVNSLKGVSSRMIRKKNYPSIRKKL
FT                   WGNQLWSPSYFAGSCGGAPISIIRQYIEQQQTPD"
     MKKETEIRRG RHVVFNLHVH LVFVTKYRGE VFTQAILNDL HTIFEAVCAD FEAKLVEFDG        60
     EDDHVHLLVE YPPKVAISNL VNSLKGVSSR MIRKKNYPSI RKKLWGNQLW SPSYFAGSCG       120
     GAPISIIRQY IEQQQTPD                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page