(data stored in ACNUC7421 zone)

EMBL: CP000947.PE221

CP000947.PE221       Location/Qualifiers
FT   CDS             complement(243787..244248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31849"
FT                   /db_xref="InterPro:IPR009678"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW30"
FT                   /protein_id="ACA31849.1"
FT                   /translation="MRLKYQDLTDHLVAKLPPRYQANFYSWMDDGEMIDEGKIVTDKGE
FT                   ILFYLEYSAELFFHELPFKQINPLQIMAAINLWLAENDLERYMQDEYKTPFDLTLLDDE
FT                   LADLSFTLKFREPIYLNQMTETEKDLDTETEIWTAETVQEIDVLAEIEK"
     MRLKYQDLTD HLVAKLPPRY QANFYSWMDD GEMIDEGKIV TDKGEILFYL EYSAELFFHE        60
     LPFKQINPLQ IMAAINLWLA ENDLERYMQD EYKTPFDLTL LDDELADLSF TLKFREPIYL       120
     NQMTETEKDL DTETEIWTAE TVQEIDVLAE IEK                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page