(data stored in ACNUC7421 zone)

EMBL: CP000947.PE223

CP000947.PE223       Location/Qualifiers
FT   CDS             complement(244690..245571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0227"
FT                   /product="phage small terminase subunit"
FT                   /note="PFAM: phage small terminase subunit; KEGG:
FT                   yps:YPTB3143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31851"
FT                   /db_xref="GOA:B0UW32"
FT                   /db_xref="InterPro:IPR010270"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW32"
FT                   /protein_id="ACA31851.1"
FT                   /translation="MGLREQQARMQELAKLEQAQLNAQANASAEMPSVTQSAVLIALNQ
FT                   DVEKIRQFSAFADRNEYKRTQFLPKWMPFVEQHFNDGRADQNDVIGYCLVYLLDIGHFE
FT                   QAFNLAEKAITNGQRLPERFKSTIPTFMAKHMLDWTIHTTAMGSPVEPYFSQTFEKVAT
FT                   TWQLNEVLVSAWFKQAAIQLLKNATGKAHAASVSDPMRLISAIKLLKKSLYLNPKSGVN
FT                   SLISRCFMRLNALIIGLNDEGINVSDLIDPAQQAALAENNPEIDIKAVIALLNRPPCSF
FT                   DEVVKEMRGKHA"
     MGLREQQARM QELAKLEQAQ LNAQANASAE MPSVTQSAVL IALNQDVEKI RQFSAFADRN        60
     EYKRTQFLPK WMPFVEQHFN DGRADQNDVI GYCLVYLLDI GHFEQAFNLA EKAITNGQRL       120
     PERFKSTIPT FMAKHMLDWT IHTTAMGSPV EPYFSQTFEK VATTWQLNEV LVSAWFKQAA       180
     IQLLKNATGK AHAASVSDPM RLISAIKLLK KSLYLNPKSG VNSLISRCFM RLNALIIGLN       240
     DEGINVSDLI DPAQQAALAE NNPEIDIKAV IALLNRPPCS FDEVVKEMRG KHA              293
//

If you have problems or comments...

PBIL Back to PBIL home page