(data stored in ACNUC7421 zone)

EMBL: CP000947.PE224

CP000947.PE224       Location/Qualifiers
FT   CDS             complement(245600..246631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0228"
FT                   /product="phage major capsid protein, P2 family"
FT                   /note="TIGRFAM: phage major capsid protein, P2 family;
FT                   PFAM: phage major capsid protein P2; KEGG: pat:Patl_0697
FT                   phage major capsid protein, P2 family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31852"
FT                   /db_xref="InterPro:IPR006441"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW33"
FT                   /protein_id="ACA31852.1"
FT                   /translation="MNRKQIYNAFIQAIAQHYNVPFAEVRLGEEFSLEAPKAALLGSNI
FT                   QQSSDFLKEINMVQVTDLKGLKLWGATEKGITGRKPTERHIATLNHTQTGYELARTDSG
FT                   ILVPWDMFDQFARFGDKLPALYAEFFNKQVALDMLQVGWHGKSVAPTTSQSDLSDVNKG
FT                   WLALLKEQKSANVYTGNSSHKINLYGTDAEFANLDELALDLKQGLDLRHQNRTDLVFLV
FT                   GADLVNVESKYISKASKLTATERAALGSHNLVNTFAGMRAIIPPNFPAKGAAVTTLNNL
FT                   SIYTQSSSVRRRFESNQDKMGIITSYYRNEGYVVEDTGLMTAIEAENVVIGKPDKPMAQ
FT                   ASD"
     MNRKQIYNAF IQAIAQHYNV PFAEVRLGEE FSLEAPKAAL LGSNIQQSSD FLKEINMVQV        60
     TDLKGLKLWG ATEKGITGRK PTERHIATLN HTQTGYELAR TDSGILVPWD MFDQFARFGD       120
     KLPALYAEFF NKQVALDMLQ VGWHGKSVAP TTSQSDLSDV NKGWLALLKE QKSANVYTGN       180
     SSHKINLYGT DAEFANLDEL ALDLKQGLDL RHQNRTDLVF LVGADLVNVE SKYISKASKL       240
     TATERAALGS HNLVNTFAGM RAIIPPNFPA KGAAVTTLNN LSIYTQSSSV RRRFESNQDK       300
     MGIITSYYRN EGYVVEDTGL MTAIEAENVV IGKPDKPMAQ ASD                         343
//

If you have problems or comments...

PBIL Back to PBIL home page