(data stored in ACNUC7421 zone)

EMBL: CP000947.PE225

CP000947.PE225       Location/Qualifiers
FT   CDS             complement(246641..247066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31853"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW34"
FT                   /protein_id="ACA31853.1"
FT                   /translation="MKSPNKKKNHFFSKFFNWLFSGEQPEIKENQENTANTGNPTAIEI
FT                   DNMDKQEFSTLIATAVAGAVAQAFSEQAEQQQEKEQAADKPTEQPAETVSKQEFNELKT
FT                   KYDVLEAKFNQLLQPVTQTPSELGNADNMFNLENSGF"
     MKSPNKKKNH FFSKFFNWLF SGEQPEIKEN QENTANTGNP TAIEIDNMDK QEFSTLIATA        60
     VAGAVAQAFS EQAEQQQEKE QAADKPTEQP AETVSKQEFN ELKTKYDVLE AKFNQLLQPV       120
     TQTPSELGNA DNMFNLENSG F                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page