(data stored in ACNUC7421 zone)

EMBL: CP000947.PE226

CP000947.PE226       Location/Qualifiers
FT   CDS             complement(247017..247538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0230"
FT                   /product="phage capsid scaffolding"
FT                   /note="PFAM: phage capsid scaffolding; KEGG: hch:HCH_00395
FT                   flagellar biosynthesis/type III secretory pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31855"
FT                   /db_xref="GOA:B0UW35"
FT                   /db_xref="InterPro:IPR009228"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW35"
FT                   /protein_id="ACA31855.1"
FT                   /translation="MKTELFTNFVCIATAGATVDGRHIDAQDLKDMAESYNPEVYTALI
FT                   WLEHYRNFGNYGRVVELKTEDEEGKTKLYARLAPNAQLLELNQSGQKIFTSIEITPNFA
FT                   QTGKAYLSGLAITDSPASTGTNALMFNRIGSKDVIISDHLEFNINFPQEVHNMNEITEQ
FT                   EKKSLFQQVF"
     MKTELFTNFV CIATAGATVD GRHIDAQDLK DMAESYNPEV YTALIWLEHY RNFGNYGRVV        60
     ELKTEDEEGK TKLYARLAPN AQLLELNQSG QKIFTSIEIT PNFAQTGKAY LSGLAITDSP       120
     ASTGTNALMF NRIGSKDVII SDHLEFNINF PQEVHNMNEI TEQEKKSLFQ QVF              173
//

If you have problems or comments...

PBIL Back to PBIL home page