(data stored in ACNUC7421 zone)

EMBL: CP000947.PE227

CP000947.PE227       Location/Qualifiers
FT   CDS             247701..249488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0231"
FT                   /product="protein of unknown function DUF264"
FT                   /note="PFAM: protein of unknown function DUF264; putative
FT                   terminase ATPase subunit; KEGG: yps:YPTB3140 possible
FT                   [Haemophilus phage HP1] orf16-like phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31856"
FT                   /db_xref="GOA:B0UW36"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR010332"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW36"
FT                   /protein_id="ACA31856.1"
FT                   /translation="MPISKLRKRKSKYDDEVIYQARYLYLKKYSPQEIVKELGLNSPRP
FT                   VYYWAEKYNWRNLINEQGIEELIALRIVALIEREGKTDQEIKELESLIEKDLQYKHQRA
FT                   KQAQKTKENSTALFAEETPGRKSKKKAAVKNDISHITDDMFEPFLSSLFDYQLRAREQK
FT                   ALHKVRMILKSRQIGATYYFAFEALEDAIKTGDNQIFLSASKKQAEIFKTYITKMARQY
FT                   FNVELKGNPIILSNGAELHFLSTNKSTAQGYHGHVYGDEFAWLRNFKEFYTVASAMATH
FT                   KKWRETYFSTPSSKLHESYAFWSGDMWKESDKKRRDIVFPSLEQMCNGGVVCPDGAWRY
FT                   VITIHDALKGGAGVLFDLDQLKQKYSALAFKQLFECHWIDDEDSIFTISKLLKCAVNIN
FT                   KWADFQPDTPRPFGDREVWGGYDPAHSSDGASFVIVAPPINEGEKFRVLARYQWFGLSY
FT                   RWQAEQIKKLYQQYNFSYIGIDANGVGQGVFEMIQEFARREARPILYSLETKSGLVLKV
FT                   HDLVERGLIEWSEEEKDIAASFLMIKQTSTQSGAKITFTADRTSQLQHADVFWAIAHAI
FT                   NKKSLIDDRPRRRSVWRIN"
     MPISKLRKRK SKYDDEVIYQ ARYLYLKKYS PQEIVKELGL NSPRPVYYWA EKYNWRNLIN        60
     EQGIEELIAL RIVALIEREG KTDQEIKELE SLIEKDLQYK HQRAKQAQKT KENSTALFAE       120
     ETPGRKSKKK AAVKNDISHI TDDMFEPFLS SLFDYQLRAR EQKALHKVRM ILKSRQIGAT       180
     YYFAFEALED AIKTGDNQIF LSASKKQAEI FKTYITKMAR QYFNVELKGN PIILSNGAEL       240
     HFLSTNKSTA QGYHGHVYGD EFAWLRNFKE FYTVASAMAT HKKWRETYFS TPSSKLHESY       300
     AFWSGDMWKE SDKKRRDIVF PSLEQMCNGG VVCPDGAWRY VITIHDALKG GAGVLFDLDQ       360
     LKQKYSALAF KQLFECHWID DEDSIFTISK LLKCAVNINK WADFQPDTPR PFGDREVWGG       420
     YDPAHSSDGA SFVIVAPPIN EGEKFRVLAR YQWFGLSYRW QAEQIKKLYQ QYNFSYIGID       480
     ANGVGQGVFE MIQEFARREA RPILYSLETK SGLVLKVHDL VERGLIEWSE EEKDIAASFL       540
     MIKQTSTQSG AKITFTADRT SQLQHADVFW AIAHAINKKS LIDDRPRRRS VWRIN            595
//

If you have problems or comments...

PBIL Back to PBIL home page