(data stored in ACNUC7421 zone)

EMBL: CP000947.PE228

CP000947.PE228       Location/Qualifiers
FT   CDS             249499..250527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0232"
FT                   /product="phage portal protein, PBSX family"
FT                   /note="TIGRFAM: phage portal protein, PBSX family; PFAM:
FT                   phage portal protein; KEGG: sgl:SG0244 putative phage
FT                   capsid portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31857"
FT                   /db_xref="InterPro:IPR006430"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW37"
FT                   /protein_id="ACA31857.1"
FT                   /translation="MKKQKNTNKPIMFSFQPQGDWELSMPPALDYTGIYFNDFYQCYEP
FT                   PIKRWSLARLPSQNAQHCGILHSRANMIAADYDQGGLSKMDMRAACLNLIQFGDVGLLK
FT                   VRNGFGQVVKLITLSSLYLRKTKEGNYRYLVRRSLTDTEQSDILTYPAQDIIFIKLYDP
FT                   MQQVYGVPDYMGGIQSALLNSDATTFRRRYFANGSHLGFILYTTDPNVTEEMEENINKS
FT                   LNGSQGVGNFKSMFVNSPDGHPDGLKVIPIGDTGKKDEFGTIKNVSAQDVLTAHRYPPG
FT                   LSGVIPQTGSFGDPLKMRLAYRQDEVLPMQDLISSSINGDIEIARNKALQISFKQRQIL
FT                   QK"
     MKKQKNTNKP IMFSFQPQGD WELSMPPALD YTGIYFNDFY QCYEPPIKRW SLARLPSQNA        60
     QHCGILHSRA NMIAADYDQG GLSKMDMRAA CLNLIQFGDV GLLKVRNGFG QVVKLITLSS       120
     LYLRKTKEGN YRYLVRRSLT DTEQSDILTY PAQDIIFIKL YDPMQQVYGV PDYMGGIQSA       180
     LLNSDATTFR RRYFANGSHL GFILYTTDPN VTEEMEENIN KSLNGSQGVG NFKSMFVNSP       240
     DGHPDGLKVI PIGDTGKKDE FGTIKNVSAQ DVLTAHRYPP GLSGVIPQTG SFGDPLKMRL       300
     AYRQDEVLPM QDLISSSING DIEIARNKAL QISFKQRQIL QK                          342
//

If you have problems or comments...

PBIL Back to PBIL home page