(data stored in ACNUC7421 zone)

EMBL: CP000947.PE23

CP000947.PE23        Location/Qualifiers
FT   CDS             complement(18963..19409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0023"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: hso:HS_0157
FT                   conserved hypothetical protein, with rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31854"
FT                   /db_xref="GOA:B0UUY1"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUY1"
FT                   /protein_id="ACA31854.1"
FT                   /translation="MQEYLPLATEFAKNHSLMVIAWIAVFVMLIYTSVKSFTSKVTAVE
FT                   NAEATRLINNEEAIVIDLRTIDEFQRGHIINSINVLPTEIKNQNLGKIEQHKDTPVILV
FT                   CATGMNAGASAELLVKQGFSRVYSLKDGISGWIAANLPLVKKHK"
     MQEYLPLATE FAKNHSLMVI AWIAVFVMLI YTSVKSFTSK VTAVENAEAT RLINNEEAIV        60
     IDLRTIDEFQ RGHIINSINV LPTEIKNQNL GKIEQHKDTP VILVCATGMN AGASAELLVK       120
     QGFSRVYSLK DGISGWIAAN LPLVKKHK                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page