(data stored in ACNUC7421 zone)

EMBL: CP000947.PE230

CP000947.PE230       Location/Qualifiers
FT   CDS             complement(250962..251357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31859"
FT                   /db_xref="GOA:B0UW39"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW39"
FT                   /protein_id="ACA31859.1"
FT                   /translation="MKIKMRFLTEVAEIEPRPSKDKIYPIGTIIIQISATRGEVLYLRK
FT                   ESKIEDRYAVISPKEQIQSFYLFSIIEKYFPKFFLQYKQGLNFKAEDLKRFKLPVHEEQ
FT                   KQRNIIAKMMMLCGCEPKKFYENIPTI"
     MKIKMRFLTE VAEIEPRPSK DKIYPIGTII IQISATRGEV LYLRKESKIE DRYAVISPKE        60
     QIQSFYLFSI IEKYFPKFFL QYKQGLNFKA EDLKRFKLPV HEEQKQRNII AKMMMLCGCE       120
     PKKFYENIPT I                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page