(data stored in ACNUC7421 zone)

EMBL: CP000947.PE231

CP000947.PE231       Location/Qualifiers
FT   CDS             complement(251354..252739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0235"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: ldb:Ldb1052 type I
FT                   restriction-modification system, modification subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31860"
FT                   /db_xref="GOA:B0UW40"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW40"
FT                   /protein_id="ACA31860.1"
FT                   /translation="MKITELLNLKWDYQITEHLINLLFDKQKRNEVFARYLSQKPDLSQ
FT                   DCFLQEFQENFADRKSLKQDFTPSAICQLVSRLTPEVDSVLDVCAGTGALTIAKWKVNP
FT                   NATFYCQEYSKEAIAFLLFNLCVRGITAEVKHCDVLTGETFAEYRLTRNGQYSDIENTK
FT                   LDWRGLKVDCVVSNPPYSAKWNPVSDERFEYFGLAPKNAADYAFVLHGLHHLKEEGTAH
FT                   FILPHGVLFRGNSEGKIRQKLIEQGYFSSVIGLPDNLFISAKIPTAILTFKKQSSDIYV
FT                   IDAADLFEKAKSNNIMRPEHVNQVLTAYQLRHNIDKLAHLANYTEIQQNDFNLNIPRYV
FT                   DKSEPDPEIDLLKEAQELLDLTNDIEKSGQAFVAMLAELEMTHGSAEDKAEFEQVKQIL
FT                   AQVFAPRTKEKKAIQQLISSKQGSLFITEQEVEQFTGFIEHELKIISQLETIKKYFLSK
FT                   MFI"
     MKITELLNLK WDYQITEHLI NLLFDKQKRN EVFARYLSQK PDLSQDCFLQ EFQENFADRK        60
     SLKQDFTPSA ICQLVSRLTP EVDSVLDVCA GTGALTIAKW KVNPNATFYC QEYSKEAIAF       120
     LLFNLCVRGI TAEVKHCDVL TGETFAEYRL TRNGQYSDIE NTKLDWRGLK VDCVVSNPPY       180
     SAKWNPVSDE RFEYFGLAPK NAADYAFVLH GLHHLKEEGT AHFILPHGVL FRGNSEGKIR       240
     QKLIEQGYFS SVIGLPDNLF ISAKIPTAIL TFKKQSSDIY VIDAADLFEK AKSNNIMRPE       300
     HVNQVLTAYQ LRHNIDKLAH LANYTEIQQN DFNLNIPRYV DKSEPDPEID LLKEAQELLD       360
     LTNDIEKSGQ AFVAMLAELE MTHGSAEDKA EFEQVKQILA QVFAPRTKEK KAIQQLISSK       420
     QGSLFITEQE VEQFTGFIEH ELKIISQLET IKKYFLSKMF I                           461
//

If you have problems or comments...

PBIL Back to PBIL home page