(data stored in ACNUC7421 zone)

EMBL: CP000947.PE232

CP000947.PE232       Location/Qualifiers
FT   CDS             complement(252756..253286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31861"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW41"
FT                   /protein_id="ACA31861.1"
FT                   /translation="MIVNNKWIPEVPRPTLEDDAFAAFIKAWIEEEYPDHCEDIPAEET
FT                   GLYETLLRNWAGFDDLMAEEFIKFHGWSYAQAKEFEEKSLSFAIDKKESEMIQQWVAEN
FT                   GYTLPFPVGSRVKIDTWRGAVYGVIAQNQDQYFSKKGQAIVQIDREHAIEIEGGEVLDK
FT                   RSFPWEMLELVKS"
     MIVNNKWIPE VPRPTLEDDA FAAFIKAWIE EEYPDHCEDI PAEETGLYET LLRNWAGFDD        60
     LMAEEFIKFH GWSYAQAKEF EEKSLSFAID KKESEMIQQW VAENGYTLPF PVGSRVKIDT       120
     WRGAVYGVIA QNQDQYFSKK GQAIVQIDRE HAIEIEGGEV LDKRSFPWEM LELVKS           176
//

If you have problems or comments...

PBIL Back to PBIL home page