(data stored in ACNUC7421 zone)

EMBL: CP000947.PE233

CP000947.PE233       Location/Qualifiers
FT   CDS             complement(253301..255490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0237"
FT                   /product="unknown protein"
FT                   /note="KEGG: pmu:PM1782 unknown"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31862"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW42"
FT                   /protein_id="ACA31862.1"
FT                   /translation="MIVKKKNLKNAPNVKDFKKQAINTTDIAFIIVGEDAWSYAGKKGK
FT                   YILSHYGTLKDKFGVFLPEKPIVLGPKQIEQISSLRIIPENHKKVRIMEAGEFSPIKKT
FT                   ALLLNLAQNSKANDVVFVDLLGEPLEDVSDYLEKLRTDSEDLAFAEQVVGYEPDIETHK
FT                   EPYVDEREEGKLNGLFYVVPKVDRDTGAVINEKLSWICSPLTLVGNGRNDIGDYYYLFK
FT                   WKHFSQKESHIEAVSLADFGTEAGWRQLKRKGLLMTAKNLTNHLVEHFHVLSRQAPFWK
FT                   VTASTGWQDSAYLLPSGEIIGEPSKPIYFNGESGSASGYRTKGTLNDWQREIAQNLKGN
FT                   PSMMLGVAVALAAPLLAILGRDSFGVHLYAESSKGKTTILNIANSLYGDPDKIKLSWSA
FT                   TAVGVKNEAAARNDGLITLDEIGQAKDAKNLEAIAYDLFNETGKLQGKKEGGNKDINRW
FT                   KVTALSTGEKDLETQLALQGVKVHAGQLVRLINIPLEEAKNLHYFTNNKSHADHLNESV
FT                   REYYGTAGREWIAFLAKNAELAKESYKIIRKKWADLADNMSGQVQRVATDRFAVLETAL
FT                   HLASHITQWSIEENQQVILKNFLNWKEEYGENSREETKLIANLMDWITMNEGAFVEYPT
FT                   DQNAKTPNKIYGIKILEDEFRGEGGYFYVIPQAFKEATQGYPRNMALKILANAKILQSP
FT                   TTPEKGYEYQFKVPKKMLGRQIRAYKITPILEETH"
     MIVKKKNLKN APNVKDFKKQ AINTTDIAFI IVGEDAWSYA GKKGKYILSH YGTLKDKFGV        60
     FLPEKPIVLG PKQIEQISSL RIIPENHKKV RIMEAGEFSP IKKTALLLNL AQNSKANDVV       120
     FVDLLGEPLE DVSDYLEKLR TDSEDLAFAE QVVGYEPDIE THKEPYVDER EEGKLNGLFY       180
     VVPKVDRDTG AVINEKLSWI CSPLTLVGNG RNDIGDYYYL FKWKHFSQKE SHIEAVSLAD       240
     FGTEAGWRQL KRKGLLMTAK NLTNHLVEHF HVLSRQAPFW KVTASTGWQD SAYLLPSGEI       300
     IGEPSKPIYF NGESGSASGY RTKGTLNDWQ REIAQNLKGN PSMMLGVAVA LAAPLLAILG       360
     RDSFGVHLYA ESSKGKTTIL NIANSLYGDP DKIKLSWSAT AVGVKNEAAA RNDGLITLDE       420
     IGQAKDAKNL EAIAYDLFNE TGKLQGKKEG GNKDINRWKV TALSTGEKDL ETQLALQGVK       480
     VHAGQLVRLI NIPLEEAKNL HYFTNNKSHA DHLNESVREY YGTAGREWIA FLAKNAELAK       540
     ESYKIIRKKW ADLADNMSGQ VQRVATDRFA VLETALHLAS HITQWSIEEN QQVILKNFLN       600
     WKEEYGENSR EETKLIANLM DWITMNEGAF VEYPTDQNAK TPNKIYGIKI LEDEFRGEGG       660
     YFYVIPQAFK EATQGYPRNM ALKILANAKI LQSPTTPEKG YEYQFKVPKK MLGRQIRAYK       720
     ITPILEETH                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page