(data stored in ACNUC7421 zone)

EMBL: CP000947.PE234

CP000947.PE234       Location/Qualifiers
FT   CDS             complement(255487..255756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31863"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW43"
FT                   /protein_id="ACA31863.1"
FT                   /translation="MSKSSVVRFAMEAQLKETISTLNAYVDYLFEIQHIGASSDSPEFN
FT                   HKKSDRYFIAMDNLCYTLDMHLKSWREIAQNEQLGRYSTSREEI"
     MSKSSVVRFA MEAQLKETIS TLNAYVDYLF EIQHIGASSD SPEFNHKKSD RYFIAMDNLC        60
     YTLDMHLKSW REIAQNEQLG RYSTSREEI                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page