(data stored in ACNUC7421 zone)

EMBL: CP000947.PE235

CP000947.PE235       Location/Qualifiers
FT   CDS             complement(255749..256237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31864"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW44"
FT                   /protein_id="ACA31864.1"
FT                   /translation="MSLKRYRNMTKIKFSVLPKNQSAVSIGDTTTKNGYRTRKTCGIFL
FT                   PQIPIINGLSLLSSICLSEFVARSIRRDKAEFIRTNKASRFFAVVETLLHPLGNSNSHL
FT                   LNKETIKMLFKFILFLGKNRLKIAIRAKSIQQARQQLNLTQHQAVFVARINTKGGLYV"
     MSLKRYRNMT KIKFSVLPKN QSAVSIGDTT TKNGYRTRKT CGIFLPQIPI INGLSLLSSI        60
     CLSEFVARSI RRDKAEFIRT NKASRFFAVV ETLLHPLGNS NSHLLNKETI KMLFKFILFL       120
     GKNRLKIAIR AKSIQQARQQ LNLTQHQAVF VARINTKGGL YV                          162
//

If you have problems or comments...

PBIL Back to PBIL home page