(data stored in ACNUC7421 zone)

EMBL: CP000947.PE236

CP000947.PE236       Location/Qualifiers
FT   CDS             complement(256389..256667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31866"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW45"
FT                   /protein_id="ACA31866.1"
FT                   /translation="MMSNTNYQANQENAFKPDLEGIKNTLETSRDLIIQLKEKKPVMAF
FT                   NDEGQEVQLSQEKILDIVLTQLFCSIDDIDEIQSKRLEPIAKTIEEP"
     MMSNTNYQAN QENAFKPDLE GIKNTLETSR DLIIQLKEKK PVMAFNDEGQ EVQLSQEKIL        60
     DIVLTQLFCS IDDIDEIQSK RLEPIAKTIE EP                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page